Lineage for d2v6bc1 (2v6b C:22-164)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846741Species Deinococcus radiodurans [TaxId:1299] [225329] (1 PDB entry)
  8. 2846744Domain d2v6bc1: 2v6b C:22-164 [206243]
    Other proteins in same PDB: d2v6ba2, d2v6bb2, d2v6bc2, d2v6bd2
    automated match to d1llda1

Details for d2v6bc1

PDB Entry: 2v6b (more details), 2.5 Å

PDB Description: crystal structure of lactate dehydrogenase from deinococcus radiodurans (apo form)
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2v6bc1:

Sequence, based on SEQRES records: (download)

>d2v6bc1 c.2.1.0 (C:22-164) automated matches {Deinococcus radiodurans [TaxId: 1299]}
mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
ghseladaqvviltaganqkpgesrldlleknadifrelvpqitraapdavllvtsnpvd
lltdlatqlapgqpvigsg

Sequence, based on observed residues (ATOM records): (download)

>d2v6bc1 c.2.1.0 (C:22-164) automated matches {Deinococcus radiodurans [TaxId: 1299]}
mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
ghseladaqvviltagsrldlleknadifrelvpqitraapdavllvtsnpvdlltdlat
qlapgqpvigsg

SCOPe Domain Coordinates for d2v6bc1:

Click to download the PDB-style file with coordinates for d2v6bc1.
(The format of our PDB-style files is described here.)

Timeline for d2v6bc1: