|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain | 
|  | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)  precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function | 
|  | Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) | 
|  | Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species) subunit of acetyl-CoA and pyruvate carboxylases | 
|  | Species Escherichia coli [TaxId:562] [52443] (24 PDB entries) | 
|  | Domain d2v58b1: 2v58 B:1-114 [206214] Other proteins in same PDB: d2v58a2, d2v58a3, d2v58b2, d2v58b3 automated match to d1dv1a2 complexed with cl, lzj | 
PDB Entry: 2v58 (more details), 2.1 Å
SCOPe Domain Sequences for d2v58b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v58b1 c.30.1.1 (B:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg
Timeline for d2v58b1: