Lineage for d2rcyd1 (2rcy D:5-156)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831841Species Plasmodium falciparum [TaxId:36329] [225359] (3 PDB entries)
  8. 1831845Domain d2rcyd1: 2rcy D:5-156 [206080]
    Other proteins in same PDB: d2rcya2, d2rcyb2, d2rcyc2, d2rcyd2, d2rcye2
    automated match to d2ahra2
    complexed with gol, mg, nap

Details for d2rcyd1

PDB Entry: 2rcy (more details), 2.3 Å

PDB Description: crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound
PDB Compounds: (D:) Pyrroline carboxylate reductase

SCOPe Domain Sequences for d2rcyd1:

Sequence, based on SEQRES records: (download)

>d2rcyd1 c.2.1.0 (D:5-156) automated matches {Plasmodium falciparum [TaxId: 36329]}
iklgfmglgqmgsalahgiananiikkenlfyygpskknttlnymssneelarhcdiivc
avkpdiagsvlnnikpylsskllisicgglnigkleemvgsenkivwvmpntpclvgegs
fiycsnknvnstdkkyvndifnscgiiheike

Sequence, based on observed residues (ATOM records): (download)

>d2rcyd1 c.2.1.0 (D:5-156) automated matches {Plasmodium falciparum [TaxId: 36329]}
iklgfmglgqmgsalahgiananiilfyygpskkttlnymssneeliivcavkpdiagsv
lnnikpylsskllisicgglnigkleemvgsenkivwvmpntpclvgegsfiycsnknvn
stdkkyvndifnscgiiheike

SCOPe Domain Coordinates for d2rcyd1:

Click to download the PDB-style file with coordinates for d2rcyd1.
(The format of our PDB-style files is described here.)

Timeline for d2rcyd1: