Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [225359] (3 PDB entries) |
Domain d2rcye1: 2rcy E:7-156 [206082] Other proteins in same PDB: d2rcya2, d2rcyb2, d2rcyc2, d2rcyd2, d2rcye2 automated match to d2ahra2 complexed with gol, mg, nap |
PDB Entry: 2rcy (more details), 2.3 Å
SCOPe Domain Sequences for d2rcye1:
Sequence, based on SEQRES records: (download)
>d2rcye1 c.2.1.0 (E:7-156) automated matches {Plasmodium falciparum [TaxId: 36329]} lgfmglgqmgsalahgiananiikkenlfyygpskknttlnymssneelarhcdiivcav kpdiagsvlnnikpylsskllisicgglnigkleemvgsenkivwvmpntpclvgegsfi ycsnknvnstdkkyvndifnscgiiheike
>d2rcye1 c.2.1.0 (E:7-156) automated matches {Plasmodium falciparum [TaxId: 36329]} lgfmglgqmgsalahgiananlfyygpskknttlnymssneearhiivcavkpdiagsvl nnikpylsskllisicgglnigkleemvgsivwvmpntpclvgegsfiycsnknvnstdk kyvndifnscgiiheike
Timeline for d2rcye1: