Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
Protein automated matches [226871] (15 species) not a true protein |
Species Leptospira interrogans [TaxId:173] [225434] (2 PDB entries) |
Domain d2rc6d2: 2rc6 D:159-314 [206057] Other proteins in same PDB: d2rc6a1, d2rc6b1, d2rc6c1, d2rc6d1 automated match to d1qufa2 complexed with fad, nap, so4, zn |
PDB Entry: 2rc6 (more details), 2.7 Å
SCOPe Domain Sequences for d2rc6d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rc6d2 c.25.1.0 (D:159-314) automated matches {Leptospira interrogans [TaxId: 173]} lpntdfsgdimflatgtgiapfigmseellehklikftgnitlvygapysdelvmmdylk gleskhknfklitaisreeknsfdggrmyishrvreqaeavkkilngggrfyicggpkgm ekgvieeiqkisgntgtyeefkhhlegahqlfvety
Timeline for d2rc6d2: