Lineage for d2r6r11 (2r6r 1:8-204)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592224Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1592225Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1592226Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1592227Protein Cell-division protein FtsZ [52492] (9 species)
  7. 1592228Species Aquifex aeolicus [TaxId:224324] [225357] (1 PDB entry)
  8. 1592229Domain d2r6r11: 2r6r 1:8-204 [205972]
    Other proteins in same PDB: d2r6r12
    automated match to d1rq2a1
    complexed with gdp

Details for d2r6r11

PDB Entry: 2r6r (more details), 1.7 Å

PDB Description: Aquifex aeolicus FtsZ
PDB Compounds: (1:) cell division protein ftsz

SCOPe Domain Sequences for d2r6r11:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r6r11 c.32.1.1 (1:8-204) Cell-division protein FtsZ {Aquifex aeolicus [TaxId: 224324]}
ckikvigvggggsnavnrmyedgiegvelyaintdvqhlstlkvpnkiqigekvtrglga
gakpevgeeaaledidkikeilrdtdmvfisaglgggtgtgaapviaktakemgiltvav
atlpfrfegprkmekalkgleklkessdayivihndkikelsnrtltikdafkevdsvls
kavrgitsivvtpavin

SCOPe Domain Coordinates for d2r6r11:

Click to download the PDB-style file with coordinates for d2r6r11.
(The format of our PDB-style files is described here.)

Timeline for d2r6r11:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r6r12