Lineage for d2qlpf_ (2qlp F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560650Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1560651Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1560664Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)
  7. 1560700Species Mycobacterium tuberculosis [TaxId:83332] [188349] (3 PDB entries)
  8. 1560708Domain d2qlpf_: 2qlp F: [205846]
    automated match to d2v9xj_
    complexed with 1pe

Details for d2qlpf_

PDB Entry: 2qlp (more details), 2.47 Å

PDB Description: Bifunctional dCTP deaminase:dUTPase from Mycobacterium tuberculosis, apo form
PDB Compounds: (F:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d2qlpf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlpf_ b.85.4.1 (F:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]}
mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
gfsghitlelsnvanlpitlwpgmkigqlcmlrltsps

SCOPe Domain Coordinates for d2qlpf_:

Click to download the PDB-style file with coordinates for d2qlpf_.
(The format of our PDB-style files is described here.)

Timeline for d2qlpf_: