SCOPe 2.05: Domain d2qlpf_: 2qlp F:

Lineage for d2qlpf_ (2qlp F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:83332] [188349] (3 PDB entries)

8. Domain d2qlpf_: 2qlp F: [205846]
   automated match to d2v9xj_
   complexed with 1pe

Details for d2qlpf_

PDB Entry: 2qlp, 2.47 Å

PDB Description: Bifunctional dCTP deaminase:dUTPase from Mycobacterium tuberculosis, apo form

PDB Compounds: (F:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d2qlpf_:

Sequence; same for both SEQRES and ATOM records:

>d2qlpf_ b.85.4.1 (F:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]}
mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
gfsghitlelsnvanlpitlwpgmkigqlcmlrltsps

Timeline for d2qlpf_:

• d2qlpf_ first appeared in SCOPe 2.03
  
• d2qlpf_ appears in SCOPe 2.04
  
• d2qlpf_ appears in SCOPe 2.06
  
• d2qlpf_ appears in the current release, SCOPe 2.08