Lineage for d2qlpd_ (2qlp D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1809317Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1809467Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1809468Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1809481Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)
  7. 1809517Species Mycobacterium tuberculosis [TaxId:83332] [188349] (3 PDB entries)
  8. 1809523Domain d2qlpd_: 2qlp D: [205844]
    automated match to d2v9xj_
    complexed with 1pe

Details for d2qlpd_

PDB Entry: 2qlp (more details), 2.47 Å

PDB Description: Bifunctional dCTP deaminase:dUTPase from Mycobacterium tuberculosis, apo form
PDB Compounds: (D:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d2qlpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlpd_ b.85.4.1 (D:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]}
mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
gfsghitlelsnvanlpitlwpgmkigqlcmlrltspseh

SCOPe Domain Coordinates for d2qlpd_:

Click to download the PDB-style file with coordinates for d2qlpd_.
(The format of our PDB-style files is described here.)

Timeline for d2qlpd_: