| Class b: All beta proteins [48724] (176 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
| Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
| Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species) |
| Species Mycobacterium tuberculosis [TaxId:83332] [188349] (3 PDB entries) |
| Domain d2qlpc_: 2qlp C: [205843] automated match to d2v9xj_ complexed with 1pe |
PDB Entry: 2qlp (more details), 2.47 Å
SCOPe Domain Sequences for d2qlpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qlpc_ b.85.4.1 (C:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]}
mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
gfsghitlelsnvanlpitlwpgmkigqlcmlrltspse
Timeline for d2qlpc_: