Class b: All beta proteins [48724] (176 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.0: automated matches [191599] (1 protein) not a true family |
Protein automated matches [191089] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189059] (2 PDB entries) |
Domain d2qjfa1: 2qjf A:233-392 [205827] Other proteins in same PDB: d2qjfa2, d2qjfb2 automated match to d1jhda1 complexed with adx, k |
PDB Entry: 2qjf (more details), 2.2 Å
SCOPe Domain Sequences for d2qjfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qjfa1 b.122.1.0 (A:233-392) automated matches {Human (Homo sapiens) [TaxId: 9606]} evkelyvpenklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereylqclh fdclldggvinlsvpivltathedkerldgctafalmyegrrvailrnpeffehrkeerc arqwgttcknhpyikmvmeqgdwliggdlqvldrvywndg
Timeline for d2qjfa1: