SCOPe 2.04: Domain d2qjfa1: 2qjf A:233-392

Lineage for d2qjfa1 (2qjf A:233-392)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189059] (2 PDB entries)

8. Domain d2qjfa1: 2qjf A:233-392 [205827]
   Other proteins in same PDB: d2qjfa2, d2qjfb2
   automated match to d1jhda1
   complexed with adx, k

Details for d2qjfa1

PDB Entry: 2qjf, 2.2 Å

PDB Description: Crystal structure of ATP-sulfurylase domain of human PAPS synthetase 1

PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d2qjfa1:

Sequence; same for both SEQRES and ATOM records:

>d2qjfa1 b.122.1.0 (A:233-392) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evkelyvpenklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereylqclh
fdclldggvinlsvpivltathedkerldgctafalmyegrrvailrnpeffehrkeerc
arqwgttcknhpyikmvmeqgdwliggdlqvldrvywndg

Timeline for d2qjfa1:

• d2qjfa1 first appeared in SCOPe 2.03
  
• d2qjfa1 appears in SCOPe 2.05
  
• d2qjfa1 appears in the current release, SCOPe 2.08