SCOPe 2.04: Domain d2qjfb2: 2qjf B:393-622

Lineage for d2qjfb2 (2qjf B:393-622)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188230] (3 PDB entries)

8. Domain d2qjfb2: 2qjf B:393-622 [205830]
   Other proteins in same PDB: d2qjfa1, d2qjfb1
   automated match to d1jhda2
   complexed with adx, k

Details for d2qjfb2

PDB Entry: 2qjf, 2.2 Å

PDB Description: Crystal structure of ATP-sulfurylase domain of human PAPS synthetase 1

PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d2qjfb2:

Sequence; same for both SEQRES and ATOM records:

>d2qjfb2 c.26.1.0 (B:393-622) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldqyrltptelkqkfkdmnadavfafqlrnpvhnghallmqdthkqllergyrrpvlllh
plggwtkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcrarmv
aganfyivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkkkrm
dyydsehhedfefisgtrmrklaregqkppegfmapkawtvlteyyksle

Timeline for d2qjfb2:

• d2qjfb2 first appeared in SCOPe 2.03
  
• d2qjfb2 appears in SCOPe 2.05
  
• d2qjfb2 appears in the current release, SCOPe 2.08