Lineage for d2qfwa_ (2qfw A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1619978Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1619979Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1619980Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1620086Protein automated matches [190072] (18 species)
    not a true protein
  7. 1620106Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225478] (4 PDB entries)
  8. 1620123Domain d2qfwa_: 2qfw A: [205789]
    automated match to d4hcxb_
    complexed with ict

Details for d2qfwa_

PDB Entry: 2qfw (more details), 2.6 Å

PDB Description: Crystal structure of Saccharomyces cerevesiae mitochondrial NADP(+)-dependent isocitrate dehydrogenase in complex with isocitrate
PDB Compounds: (A:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d2qfwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfwa_ c.77.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
skikvkqpvveldgdemtriiwdkikkklilpyldvdlkyydlsvesrdatsdkitqdaa
eaikkygvgikcatitpdearvkefnlhkmwkspngtirnilggtvfrepivipriprlv
prwekpiiigrhahgdqykatdtlipgpgslelvykpsdpttaqpqtlkvydykgsgvam
amyntdesiegfahssfklaidkklnlflstkntilkkydgrfkdifqevyeaqykskfe
qlgihyehrliddmvaqmikskggfimalknydgdvqsdivaqgfgslglmtsilvtpdg
ktfeseaahgtvtrhyrkyqkgeetstnsiasifawsrgllkrgeldntpalckfanile
satlntvqqdgimtkdlalacgnnersayvtteefldavekrlqkei

SCOPe Domain Coordinates for d2qfwa_:

Click to download the PDB-style file with coordinates for d2qfwa_.
(The format of our PDB-style files is described here.)

Timeline for d2qfwa_: