Lineage for d2q6la2 (2q6l A:177-271)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824820Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 2824821Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) (S)
  5. 2824864Family b.141.1.0: automated matches [227220] (1 protein)
    not a true family
  6. 2824865Protein automated matches [226959] (4 species)
    not a true protein
  7. 2824866Species Salinispora tropica [TaxId:369723] [225387] (6 PDB entries)
  8. 2824877Domain d2q6la2: 2q6l A:177-271 [205760]
    Other proteins in same PDB: d2q6la1, d2q6la3
    automated match to d1rqpa1
    complexed with 5cd, met; mutant

Details for d2q6la2

PDB Entry: 2q6l (more details), 2.72 Å

PDB Description: sall double mutant y70t/g131s with clda and l-met
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2q6la2:

Sequence, based on SEQRES records: (download)

>d2q6la2 b.141.1.0 (A:177-271) automated matches {Salinispora tropica [TaxId: 369723]}
gevvridrafgnvwtnipthligsmlqdgerlevkiealsdtvlelpfcktfgevdegqp
llylnsrgrlalglnqsnfiekwpvvpgdsitvsp

Sequence, based on observed residues (ATOM records): (download)

>d2q6la2 b.141.1.0 (A:177-271) automated matches {Salinispora tropica [TaxId: 369723]}
gevvridrafgnvwtnipthlirlevktvlelpfcktfgevdegqpllylnsrgrlalgl
nqsnfiekwpvvpgdsitvsp

SCOPe Domain Coordinates for d2q6la2:

Click to download the PDB-style file with coordinates for d2q6la2.
(The format of our PDB-style files is described here.)

Timeline for d2q6la2: