![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
![]() | Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) ![]() |
![]() | Family b.141.1.0: automated matches [227220] (1 protein) not a true family |
![]() | Protein automated matches [226959] (4 species) not a true protein |
![]() | Species Salinispora tropica [TaxId:369723] [225387] (6 PDB entries) |
![]() | Domain d2q6la2: 2q6l A:177-271 [205760] Other proteins in same PDB: d2q6la1, d2q6la3 automated match to d1rqpa1 complexed with 5cd, met; mutant |
PDB Entry: 2q6l (more details), 2.72 Å
SCOPe Domain Sequences for d2q6la2:
Sequence, based on SEQRES records: (download)
>d2q6la2 b.141.1.0 (A:177-271) automated matches {Salinispora tropica [TaxId: 369723]} gevvridrafgnvwtnipthligsmlqdgerlevkiealsdtvlelpfcktfgevdegqp llylnsrgrlalglnqsnfiekwpvvpgdsitvsp
>d2q6la2 b.141.1.0 (A:177-271) automated matches {Salinispora tropica [TaxId: 369723]} gevvridrafgnvwtnipthlirlevktvlelpfcktfgevdegqpllylnsrgrlalgl nqsnfiekwpvvpgdsitvsp
Timeline for d2q6la2: