PDB entry 2q6l

View 2q6l on RCSB PDB site
Description: SalL double mutant Y70T/G131S with CLDA and L-MET
Class: biosynthetic protein
Keywords: chlorinase, double mutant complex with ClDA and L-Met, BIOSYNTHETIC PROTEIN
Deposited on 2007-06-05, released 2007-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.239
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Salinispora tropica [TaxId:369723]
    Gene: salL
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4X3Q0 (2-End)
      • cloning artifact (0-1)
      • engineered (71)
      • engineered (132)
    Domains in SCOPe 2.07: d2q6la1, d2q6la2, d2q6la3
  • Heterogens: 5CD, MET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q6lA (A:)
    ggmqhnliaflsdvgsadeahalckgvmygvapaativdithdvapfdvregalfladvp
    hsfpahtvicatvypetgtathtiavrnekgqllvgpnngllsfaldaspavechevlsp
    dvmnqpvtptwyskdivaacaahlaagtdlaavgpridpkqivrlpyasaseveggirge
    vvridrafgnvwtnipthligsmlqdgerlevkiealsdtvlelpfcktfgevdegqpll
    ylnsrgrlalglnqsnfiekwpvvpgdsitvsprvpdsnlgpvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q6lA (A:)
    ggmqhnliaflsdvgsadeahalckgvmygvapaativdithdvapfdvregalfladvp
    hsfpahtvicatvypetgtathtiavrnekgqllvgpnngllsfaldaspavechevlsp
    dvmnqpvtptwyskdivaacaahlaagtdlaavgpridpkqivrlpyasasevgirgevv
    ridrafgnvwtnipthlirlevktvlelpfcktfgevdegqpllylnsrgrlalglnqsn
    fiekwpvvpgdsitvsp