SCOPe 2.08: Domain d2pzla1: 2pzl A:1-308

Lineage for d2pzla1 (2pzl A:1-308)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:518] [225344] (8 PDB entries)

8. Domain d2pzla1: 2pzl A:1-308 [205705]
   Other proteins in same PDB: d2pzla2, d2pzlb2
   automated match to d3enkb_
   complexed with nad, udp

Details for d2pzla1

PDB Entry: 2pzl, 2.39 Å

PDB Description: Crystal structure of the Bordetella bronchiseptica enzyme WbmG in complex with NAD and UDP

PDB Compounds: (A:) Putative nucleotide sugar epimerase/ dehydratase

SCOPe Domain Sequences for d2pzla1:

Sequence; same for both SEQRES and ATOM records:

>d2pzla1 c.2.1.0 (A:1-308) automated matches {Bordetella bronchiseptica [TaxId: 518]}
mrilitggagclgsnliehwlpqgheilvidnfatgkrevlppvaglsviegsvtdagll
erafdsfkpthvvhsaaaykdpddwaedaatnvqgsinvakaaskagvkrllnfqtalcy
grpatvpipidsptapftsygisktageaflmmsdvpvvslrlanvtgprlaigpiptfy
krlkagqkcfcsdtvrdfldmsdflaiadlslqegrptgvfnvstgeghsikevfdvvld
yvgatlaepvpvvapgaddvpsvvldpsktetefgwkakvdfkdtitgqlawydkygvtd
ifshlsap

Timeline for d2pzla1:

• d2pzla1 first appeared in SCOPe 2.03, called d2pzla_
  
• d2pzla1 appears in SCOPe 2.07