Lineage for d2pzha1 (2pzh A:1-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944405Species Helicobacter pylori [TaxId:85962] [225438] (1 PDB entry)
  8. 2944406Domain d2pzha1: 2pzh A:1-132 [205699]
    Other proteins in same PDB: d2pzha2, d2pzhb2, d2pzhc2, d2pzhd2
    automated match to d1s5ug_

Details for d2pzha1

PDB Entry: 2pzh (more details), 1.7 Å

PDB Description: YbgC thioesterase (Hp0496) from Helicobacter pylori
PDB Compounds: (A:) Hypothetical protein HP_0496

SCOPe Domain Sequences for d2pzha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzha1 d.38.1.0 (A:1-132) automated matches {Helicobacter pylori [TaxId: 85962]}
mrcrvyyedtdsegvvyhanylkycerarsefffkqnvlpeneegvfvirsikadfftpa
slgqvleirtqikelrkvfvvlfqeiyciqnaslepmkpfkvfaseikfgfvnrstyspi
aipklfkellna

SCOPe Domain Coordinates for d2pzha1:

Click to download the PDB-style file with coordinates for d2pzha1.
(The format of our PDB-style files is described here.)

Timeline for d2pzha1: