SCOPe 2.08: Domain d2pzhc1: 2pzh C:1-132

Lineage for d2pzhc1 (2pzh C:1-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [225438] (1 PDB entry)

8. Domain d2pzhc1: 2pzh C:1-132 [205701]
   Other proteins in same PDB: d2pzha2, d2pzhb2, d2pzhc2, d2pzhd2
   automated match to d1s5ug_

Details for d2pzhc1

PDB Entry: 2pzh, 1.7 Å

PDB Description: YbgC thioesterase (Hp0496) from Helicobacter pylori

PDB Compounds: (C:) Hypothetical protein HP_0496

SCOPe Domain Sequences for d2pzhc1:

Sequence; same for both SEQRES and ATOM records:

>d2pzhc1 d.38.1.0 (C:1-132) automated matches {Helicobacter pylori [TaxId: 85962]}
mrcrvyyedtdsegvvyhanylkycerarsefffkqnvlpeneegvfvirsikadfftpa
slgqvleirtqikelrkvfvvlfqeiyciqnaslepmkpfkvfaseikfgfvnrstyspi
aipklfkellna

Timeline for d2pzhc1:

• d2pzhc1 first appeared in SCOPe 2.03, called d2pzhc_
  
• d2pzhc1 appears in SCOPe 2.07