| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225519] (3 PDB entries) |
| Domain d2psnb1: 2psn B:1-139 [205630] Other proteins in same PDB: d2psna2, d2psnb2, d2psnc2, d2psnd2 automated match to d1pdza2 complexed with mg, po4 |
PDB Entry: 2psn (more details), 2.2 Å
SCOPe Domain Sequences for d2psnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2psnb1 d.54.1.0 (B:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
gavekgvplyrhiadlagn
Timeline for d2psnb1: