Lineage for d2psnc1 (2psn C:1-139)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2171206Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2171207Protein automated matches [226922] (87 species)
    not a true protein
  7. 2171540Species Human (Homo sapiens) [TaxId:9606] [225519] (3 PDB entries)
  8. 2171545Domain d2psnc1: 2psn C:1-139 [205632]
    Other proteins in same PDB: d2psna2, d2psnb2, d2psnc2, d2psnd2
    automated match to d1pdza2
    complexed with mg, po4

Details for d2psnc1

PDB Entry: 2psn (more details), 2.2 Å

PDB Description: Crystal structure of enolase1
PDB Compounds: (C:) Alpha-enolase

SCOPe Domain Sequences for d2psnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psnc1 d.54.1.0 (C:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
gavekgvplyrhiadlagn

SCOPe Domain Coordinates for d2psnc1:

Click to download the PDB-style file with coordinates for d2psnc1.
(The format of our PDB-style files is described here.)

Timeline for d2psnc1: