SCOPe 2.08: Domain d2psnb2: 2psn B:140-432

Lineage for d2psnb2 (2psn B:140-432)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (2 proteins)
   automatically mapped to Pfam PF00113

6. Protein automated matches [226973] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225520] (3 PDB entries)

8. Domain d2psnb2: 2psn B:140-432 [205631]
   Other proteins in same PDB: d2psna1, d2psnb1, d2psnc1, d2psnd1
   automated match to d1pdza1
   complexed with mg, po4

Details for d2psnb2

PDB Entry: 2psn, 2.2 Å

PDB Description: Crystal structure of enolase1

PDB Compounds: (B:) Alpha-enolase

SCOPe Domain Sequences for d2psnb2:

Sequence; same for both SEQRES and ATOM records:

>d2psnb2 c.1.11.1 (B:140-432) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevilpvpafnvinggshagnklamqefmilpvgaanfreamrigaevyhnlknvikeky
gkdatnvgdeggfapnilenkeglellktaigkagytdkvvigmdvaaseffrsgkydld
fkspddpsryispdqladlyksfikdypvvsiedpfdqddwgawqkftasagiqvvgddl
tvtnpkriakavnekscnclllkvnqigsvteslqacklaqangwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqllrieeelgskakfagrnfrnpla

Timeline for d2psnb2:

• d2psnb2 first appeared in SCOPe 2.03
  
• d2psnb2 appears in SCOPe 2.07