Lineage for d2pozd2 (2poz D:119-384)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445853Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2445854Protein automated matches [226923] (78 species)
    not a true protein
  7. 2446188Species Mesorhizobium loti [TaxId:266835] [225267] (1 PDB entry)
  8. 2446192Domain d2pozd2: 2poz D:119-384 [205578]
    Other proteins in same PDB: d2poza1, d2poza3, d2pozb1, d2pozb3, d2pozc1, d2pozc3, d2pozd1, d2pozd3, d2poze1, d2poze3, d2pozf1, d2pozf3, d2pozg1, d2pozg3, d2pozh1, d2pozh3
    automated match to d2gl5a1

Details for d2pozd2

PDB Entry: 2poz (more details), 2.04 Å

PDB Description: crystal structure of a putative dehydratase from mesorhizobium loti
PDB Compounds: (D:) Putative dehydratase

SCOPe Domain Sequences for d2pozd2:

Sequence, based on SEQRES records: (download)

>d2pozd2 c.1.11.0 (D:119-384) automated matches {Mesorhizobium loti [TaxId: 266835]}
kirdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsms
aeaielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfd
ngalkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamae
aynmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyf
empngpglgavlikrniepylwasct

Sequence, based on observed residues (ATOM records): (download)

>d2pozd2 c.1.11.0 (D:119-384) automated matches {Mesorhizobium loti [TaxId: 266835]}
kirdrvrayangwygaadtpdefaraverplkegygalkfyplaqlqhvtrrsmsaeaie
layrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdngalk
viseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeaynmr
vaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfempng
pglgavlikrniepylwasct

SCOPe Domain Coordinates for d2pozd2:

Click to download the PDB-style file with coordinates for d2pozd2.
(The format of our PDB-style files is described here.)

Timeline for d2pozd2: