Lineage for d2pozh1 (2poz H:4-118)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555214Species Mesorhizobium loti [TaxId:266835] [225266] (1 PDB entry)
  8. 2555222Domain d2pozh1: 2poz H:4-118 [205585]
    Other proteins in same PDB: d2poza2, d2poza3, d2pozb2, d2pozb3, d2pozc2, d2pozc3, d2pozd2, d2pozd3, d2poze2, d2poze3, d2pozf2, d2pozf3, d2pozg2, d2pozg3, d2pozh2, d2pozh3
    automated match to d2gl5a2

Details for d2pozh1

PDB Entry: 2poz (more details), 2.04 Å

PDB Description: crystal structure of a putative dehydratase from mesorhizobium loti
PDB Compounds: (H:) Putative dehydratase

SCOPe Domain Sequences for d2pozh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pozh1 d.54.1.0 (H:4-118) automated matches {Mesorhizobium loti [TaxId: 266835]}
kitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfligk
dpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfgg

SCOPe Domain Coordinates for d2pozh1:

Click to download the PDB-style file with coordinates for d2pozh1.
(The format of our PDB-style files is described here.)

Timeline for d2pozh1: