Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196470] (50 PDB entries) |
Domain d2pg6d_: 2pg6 D: [205530] Other proteins in same PDB: d2pg6b2 automated match to d1dt6a_ complexed with hem |
PDB Entry: 2pg6 (more details), 2.53 Å
SCOPe Domain Sequences for d2pg6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pg6d_ a.104.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavrea lvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriq eeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifq ftststgqlyemfssvmkhlpgpqqqafqclqgledfiakkvehnqrtldpnsprdfids flirmqeeeknpntefylknlvmttlqlfiggtetvsttlrygflllmkhpeveakvhee idrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgte vypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelf lffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr
Timeline for d2pg6d_:
View in 3D Domains from other chains: (mouse over for more information) d2pg6a_, d2pg6b1, d2pg6b2, d2pg6c_ |