Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (20 species) not a true protein |
Species Escherichia coli [TaxId:562] [225399] (1 PDB entry) |
Domain d2p4vc2: 2p4v C:80-156 [205444] Other proteins in same PDB: d2p4va1, d2p4vb1, d2p4vc1, d2p4vd1, d2p4ve1, d2p4vf1 automated match to d1grja2 |
PDB Entry: 2p4v (more details), 2.6 Å
SCOPe Domain Sequences for d2p4vc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4vc2 d.26.1.0 (C:80-156) automated matches {Escherichia coli [TaxId: 562]} qqegkvffgawveienddgvthrfrivgydeifgrkdyisidspmarallkkevgdlavv ntpageaswyvnaieyv
Timeline for d2p4vc2: