Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily) consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5 Domain 2 has parallel beta-sheet of 4 strands, order 1234 |
Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) |
Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 proteins) automatically mapped to Pfam PF00710 |
Protein automated matches [190446] (9 species) not a true protein |
Species Escherichia coli [TaxId:562] [225264] (4 PDB entries) |
Domain d2p2nc_: 2p2n C: [205433] Other proteins in same PDB: d2p2nb2, d2p2nd2 automated match to d3ntxa_ complexed with asn, asp, cl, edo |
PDB Entry: 2p2n (more details), 1.9 Å
SCOPe Domain Sequences for d2p2nc_:
Sequence, based on SEQRES records: (download)
>d2p2nc_ c.88.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]} kksiyvaytggtigmqrseqgyipvsghlqrqlalmpefhrpempdftiheytplmdssd mtpedwqhiaedikahyddydgfvilhgtdtmaytasalsfmlenlgkpvivtgsqipla elrsdgqinllnalyvaanypinevtlffnnrlyrgnrttkahadgfdafaspnlpplle agihirrlntppaphgegelivhpitpqpigvvtiypgisadvvrnflrqpvkalilrsy gvgnapqnkaflqelqeasdrgivvvnltqcmsgkvnmggyatgnalahagviggadmtv eatltklhyllsqeldtetirkamsqnlrgeltp
>d2p2nc_ c.88.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]} kksiyvaytggqlalmpefhrpempdftiheytplmdssdmtpedwqhiaedikahyddy dgfvilhgtdtmaytasalsfmlenlgkpvivtgsqiplaelrsdgqinllnalyvaany pinevtlffnnrlyrgnrttkahadgfdafaspnlpplleagihirrlntppaphgegel ivhpitpqpigvvtiypgisadvvrnflrqpvkalilrsygvgnapqnkaflqelqeasd rgivvvnltqcmsgkvnmalahagviggadmtveatltklhyllsqeldtetirkamsqn lrgeltp
Timeline for d2p2nc_: