Lineage for d2p1pa1 (2p1p A:8-47)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647603Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1647604Protein automated matches [190710] (3 species)
    not a true protein
  7. 1647655Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225248] (3 PDB entries)
  8. 1647657Domain d2p1pa1: 2p1p A:8-47 [205409]
    Other proteins in same PDB: d2p1pa2
    automated match to d2ovra2
    complexed with iac, ihp

Details for d2p1pa1

PDB Entry: 2p1p (more details), 2.21 Å

PDB Description: mechanism of auxin perception by the tir1 ubiquitin ligase
PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d2p1pa1:

Sequence, based on SEQRES records: (download)

>d2p1pa1 d.42.1.0 (A:8-47) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkssdgesfeveeavalesqtiahmveddcvdngvplpnv

Sequence, based on observed residues (ATOM records): (download)

>d2p1pa1 d.42.1.0 (A:8-47) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkssdgesfeveeavalesqtiavplpnv

SCOPe Domain Coordinates for d2p1pa1:

Click to download the PDB-style file with coordinates for d2p1pa1.
(The format of our PDB-style files is described here.)

Timeline for d2p1pa1: