| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
| Protein automated matches [190710] (3 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225248] (3 PDB entries) |
| Domain d2p1pa1: 2p1p A:8-47 [205409] Other proteins in same PDB: d2p1pa2 automated match to d2ovra2 complexed with iac, ihp |
PDB Entry: 2p1p (more details), 2.21 Å
SCOPe Domain Sequences for d2p1pa1:
Sequence, based on SEQRES records: (download)
>d2p1pa1 d.42.1.0 (A:8-47) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkssdgesfeveeavalesqtiahmveddcvdngvplpnv
>d2p1pa1 d.42.1.0 (A:8-47) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkssdgesfeveeavalesqtiavplpnv
Timeline for d2p1pa1: