Lineage for d2otdd_ (2otd D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448305Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2448392Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 2448393Protein automated matches [190919] (11 species)
    not a true protein
  7. 2448416Species Shigella flexneri [TaxId:623] [225231] (1 PDB entry)
  8. 2448420Domain d2otdd_: 2otd D: [205363]
    automated match to d2pz0a_
    complexed with po4

Details for d2otdd_

PDB Entry: 2otd (more details), 2.6 Å

PDB Description: The crystal structure of the glycerophosphodiester phosphodiesterase from Shigella flexneri 2a
PDB Compounds: (D:) glycerophosphodiester phosphodiesterase

SCOPe Domain Sequences for d2otdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otdd_ c.1.18.0 (D:) automated matches {Shigella flexneri [TaxId: 623]}
snwpyprivahrgggklapentlaaidvgakyghkmiefdaklskdgeifllhddnlert
sngwgvagelnwqdllrvdagswyskafkgeplpllsqvaercrehgmmanieikpttgt
gpltgkmvalaarqlwagmtppllssfeidaleaaqqaapelprgllldewrddwrelta
rlgcvsihlnhklldkarvmqlkdaglrilvytvnkpqhaaellrwgvdcictdaidvig
pnfta

SCOPe Domain Coordinates for d2otdd_:

Click to download the PDB-style file with coordinates for d2otdd_.
(The format of our PDB-style files is described here.)

Timeline for d2otdd_: