| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
| Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
| Protein automated matches [190919] (11 species) not a true protein |
| Species Shigella flexneri [TaxId:623] [225231] (1 PDB entry) |
| Domain d2otdd_: 2otd D: [205363] automated match to d2pz0a_ complexed with po4 |
PDB Entry: 2otd (more details), 2.6 Å
SCOPe Domain Sequences for d2otdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otdd_ c.1.18.0 (D:) automated matches {Shigella flexneri [TaxId: 623]}
snwpyprivahrgggklapentlaaidvgakyghkmiefdaklskdgeifllhddnlert
sngwgvagelnwqdllrvdagswyskafkgeplpllsqvaercrehgmmanieikpttgt
gpltgkmvalaarqlwagmtppllssfeidaleaaqqaapelprgllldewrddwrelta
rlgcvsihlnhklldkarvmqlkdaglrilvytvnkpqhaaellrwgvdcictdaidvig
pnfta
Timeline for d2otdd_: