Lineage for d1qp1a_ (1qp1 A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219237Species Bence-Jones VL (kappa) dimer BRE (human) [48924] (3 PDB entries)
  8. 219241Domain d1qp1a_: 1qp1 A: [20535]

Details for d1qp1a_

PDB Entry: 1qp1 (more details), 2.06 Å

PDB Description: kappa variable light chain

SCOP Domain Sequences for d1qp1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp1a_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer BRE (human)}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik

SCOP Domain Coordinates for d1qp1a_:

Click to download the PDB-style file with coordinates for d1qp1a_.
(The format of our PDB-style files is described here.)

Timeline for d1qp1a_: