Lineage for d2onhb1 (2onh B:57-271)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1743246Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1743570Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 1743571Protein automated matches [226931] (7 species)
    not a true protein
  7. 1743580Species Mentha spicata [TaxId:29719] [225228] (2 PDB entries)
  8. 1743582Domain d2onhb1: 2onh B:57-271 [205339]
    Other proteins in same PDB: d2onha2, d2onhb2
    automated match to d1n1ba1
    complexed with btb, f3p, mn

Details for d2onhb1

PDB Entry: 2onh (more details), 2.7 Å

PDB Description: crystal structure of of limonene synthase with 2-fluorolinalyl diphosphate(flpp)
PDB Compounds: (B:) 4S-limonene synthase

SCOPe Domain Sequences for d2onhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onhb1 a.102.4.0 (B:57-271) automated matches {Mentha spicata [TaxId: 29719]}
mrrsgnynpsrwdvnfiqsllsdykedkhviraselvtlvkmeleketdqirqleliddl
qrmglsdhfqnefkeilssiyldhhyyknpfpkeerdlystslafrllrehgfqvaqevf
dsfkneegefkeslsddtrgllqlyeasflltegettlesarefatkfleekvneggvdg
dlltriaysldiplhwrikrpnapvwiewyrkrpd

SCOPe Domain Coordinates for d2onhb1:

Click to download the PDB-style file with coordinates for d2onhb1.
(The format of our PDB-style files is described here.)

Timeline for d2onhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2onhb2