| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
| Family a.102.4.0: automated matches [227201] (1 protein) not a true family |
| Protein automated matches [226931] (12 species) not a true protein |
| Species Mentha spicata [TaxId:29719] [225228] (2 PDB entries) |
| Domain d2onhb1: 2onh B:57-271 [205339] Other proteins in same PDB: d2onha2, d2onhb2 automated match to d1n1ba1 complexed with btb, f3p, mn |
PDB Entry: 2onh (more details), 2.7 Å
SCOPe Domain Sequences for d2onhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onhb1 a.102.4.0 (B:57-271) automated matches {Mentha spicata [TaxId: 29719]}
mrrsgnynpsrwdvnfiqsllsdykedkhviraselvtlvkmeleketdqirqleliddl
qrmglsdhfqnefkeilssiyldhhyyknpfpkeerdlystslafrllrehgfqvaqevf
dsfkneegefkeslsddtrgllqlyeasflltegettlesarefatkfleekvneggvdg
dlltriaysldiplhwrikrpnapvwiewyrkrpd
Timeline for d2onhb1: