Lineage for d2on5h1 (2on5 H:1-77)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1603050Species Necator americanus [TaxId:51031] [224893] (4 PDB entries)
  8. 1603058Domain d2on5h1: 2on5 H:1-77 [205322]
    Other proteins in same PDB: d2on5a2, d2on5b2, d2on5c2, d2on5d2, d2on5e2, d2on5f2, d2on5g2, d2on5h2
    automated match to d1tw9a2
    complexed with edo, gsh

Details for d2on5h1

PDB Entry: 2on5 (more details), 1.9 Å

PDB Description: Structure of NaGST-2
PDB Compounds: (H:) Na Glutathione S-transferase 2

SCOPe Domain Sequences for d2on5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2on5h1 c.47.1.0 (H:1-77) automated matches {Necator americanus [TaxId: 51031]}
mvhykltyfagrglaepirqifalagqkyedvrytfqewpkhkdempfgqipvleedgkq
laqsfaiarylsrkfgf

SCOPe Domain Coordinates for d2on5h1:

Click to download the PDB-style file with coordinates for d2on5h1.
(The format of our PDB-style files is described here.)

Timeline for d2on5h1: