| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Necator americanus [TaxId:51031] [224893] (6 PDB entries) |
| Domain d2on5h1: 2on5 H:1-77 [205322] Other proteins in same PDB: d2on5a2, d2on5b2, d2on5c2, d2on5d2, d2on5e2, d2on5f2, d2on5g2, d2on5h2 automated match to d1tw9a2 complexed with edo, gsh |
PDB Entry: 2on5 (more details), 1.9 Å
SCOPe Domain Sequences for d2on5h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2on5h1 c.47.1.0 (H:1-77) automated matches {Necator americanus [TaxId: 51031]}
mvhykltyfagrglaepirqifalagqkyedvrytfqewpkhkdempfgqipvleedgkq
laqsfaiarylsrkfgf
Timeline for d2on5h1: