SCOPe 2.07: Domain d2ohfa2: 2ohf A:305-388

Lineage for d2ohfa2 (2ohf A:305-388)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.10: TGS-like [81271] (3 families)
   possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif

5. Family d.15.10.0: automated matches [227173] (1 protein)
   not a true family

6. Protein automated matches [226888] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225258] (1 PDB entry)

8. Domain d2ohfa2: 2ohf A:305-388 [205273]
   Other proteins in same PDB: d2ohfa1
   automated match to d1ni3a2
   complexed with acp

Details for d2ohfa2

PDB Entry: 2ohf, 2.7 Å

PDB Description: crystal structure of human ola1 in complex with amppcp

PDB Compounds: (A:) GTP-binding protein 9

SCOPe Domain Sequences for d2ohfa2:

Sequence; same for both SEQRES and ATOM records:

>d2ohfa2 d.15.10.0 (A:305-388) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leyfftagpdevrawtirkgtkapqaagkihtdfekgfimaevmkyedfkeegsenavka
agkyrqqgrnyivedgdiiffkfn

Timeline for d2ohfa2:

• d2ohfa2 first appeared in SCOPe 2.03
  
• d2ohfa2 appears in SCOPe 2.06
  
• d2ohfa2 appears in the current release, SCOPe 2.08