![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.10: TGS-like [81271] (3 families) ![]() possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
![]() | Family d.15.10.0: automated matches [227173] (1 protein) not a true family |
![]() | Protein automated matches [226888] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225258] (1 PDB entry) |
![]() | Domain d2ohfa2: 2ohf A:305-388 [205273] Other proteins in same PDB: d2ohfa1 automated match to d1ni3a2 complexed with acp |
PDB Entry: 2ohf (more details), 2.7 Å
SCOPe Domain Sequences for d2ohfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ohfa2 d.15.10.0 (A:305-388) automated matches {Human (Homo sapiens) [TaxId: 9606]} leyfftagpdevrawtirkgtkapqaagkihtdfekgfimaevmkyedfkeegsenavka agkyrqqgrnyivedgdiiffkfn
Timeline for d2ohfa2: