Lineage for d1melb_ (1mel B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739533Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 2739534Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 2739566Domain d1melb_: 1mel B: [20506]
    Other proteins in same PDB: d1mell_, d1melm_
    anti-lysozyme VHh domain

Details for d1melb_

PDB Entry: 1mel (more details), 2.5 Å

PDB Description: crystal structure of a camel single-domain vh antibody fragment in complex with lysozyme
PDB Compounds: (B:) Vh Single-Domain Antibody

SCOPe Domain Sequences for d1melb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1melb_ b.1.1.1 (B:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityya
dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd
swgqgtqvtvss

SCOPe Domain Coordinates for d1melb_:

Click to download the PDB-style file with coordinates for d1melb_.
(The format of our PDB-style files is described here.)

Timeline for d1melb_: