![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
![]() | Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries) SQ NA # camelid antibody |
![]() | Domain d1mela_: 1mel A: [20505] Other proteins in same PDB: d1mell_, d1melm_ anti-lysozyme VHh domain |
PDB Entry: 1mel (more details), 2.5 Å
SCOPe Domain Sequences for d1mela_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mela_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityya dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd swgqgtqvtvss
Timeline for d1mela_: