| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (21 species) not a true protein |
| Species Methanococcus jannaschii [TaxId:2190] [225207] (3 PDB entries) |
| Domain d2j9ec1: 2j9e C:-1-112 [205000] Other proteins in same PDB: d2j9ea2, d2j9eb2, d2j9ec2 automated match to d3ncrc_ complexed with act, akg, atp, cl, mg, na |
PDB Entry: 2j9e (more details), 1.62 Å
SCOPe Domain Sequences for d2j9ec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9ec1 d.58.5.0 (C:-1-112) automated matches {Methanococcus jannaschii [TaxId: 2190]}
gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk
vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkeal
Timeline for d2j9ec1:
View in 3DDomains from other chains: (mouse over for more information) d2j9ea1, d2j9ea2, d2j9eb1, d2j9eb2 |