Lineage for d2j9eb1 (2j9e B:-1-112)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557730Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2557731Protein automated matches [190753] (21 species)
    not a true protein
  7. 2557862Species Methanococcus jannaschii [TaxId:2190] [225207] (3 PDB entries)
  8. 2557867Domain d2j9eb1: 2j9e B:-1-112 [204999]
    Other proteins in same PDB: d2j9ea2, d2j9eb2, d2j9ec2
    automated match to d3ncrc_
    complexed with act, akg, atp, cl, mg, na

Details for d2j9eb1

PDB Entry: 2j9e (more details), 1.62 Å

PDB Description: structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake
PDB Compounds: (B:) hypothetical nitrogen regulatory pii-like protein mj0059

SCOPe Domain Sequences for d2j9eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9eb1 d.58.5.0 (B:-1-112) automated matches {Methanococcus jannaschii [TaxId: 2190]}
gsmkkveaiirpekleivkkalsdagyvgmtvsevkgrgvqggiveryrgreyivdlipk
vkielvvkeedvdnvidiicenartgnpgdgkifvipvervvrvrtkeegkeal

SCOPe Domain Coordinates for d2j9eb1:

Click to download the PDB-style file with coordinates for d2j9eb1.
(The format of our PDB-style files is described here.)

Timeline for d2j9eb1: