Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225347] (4 PDB entries) |
Domain d2imkb1: 2imk B:1-86 [204825] Other proteins in same PDB: d2imka2, d2imkb2 automated match to d1pn9a2 complexed with gtx |
PDB Entry: 2imk (more details), 1.9 Å
SCOPe Domain Sequences for d2imkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2imkb1 c.47.1.0 (B:1-86) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]} msnlvlytlhlsppcraveltakalgleleqktinlltgdhlkpefvklnpqhtipvldd ngtiiteshaimiylvtkygkddsly
Timeline for d2imkb1: