Lineage for d2imka1 (2imk A:2-86)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2486899Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225347] (4 PDB entries)
  8. 2486902Domain d2imka1: 2imk A:2-86 [204823]
    Other proteins in same PDB: d2imka2, d2imkb2
    automated match to d1pn9a2
    complexed with gtx

Details for d2imka1

PDB Entry: 2imk (more details), 1.9 Å

PDB Description: structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity
PDB Compounds: (A:) Epsilon-class Glutathione S-transferase

SCOPe Domain Sequences for d2imka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imka1 c.47.1.0 (A:2-86) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
snlvlytlhlsppcraveltakalgleleqktinlltgdhlkpefvklnpqhtipvlddn
gtiiteshaimiylvtkygkddsly

SCOPe Domain Coordinates for d2imka1:

Click to download the PDB-style file with coordinates for d2imka1.
(The format of our PDB-style files is described here.)

Timeline for d2imka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2imka2