SCOPe 2.04: Domain d2if4a1: 2if4 A:35-160

Lineage for d2if4a1 (2if4 A:35-160)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (20 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225164] (2 PDB entries)

8. Domain d2if4a1: 2if4 A:35-160 [204773]
   Other proteins in same PDB: d2if4a2
   automated match to d1kt1a2

Details for d2if4a1

PDB Entry: 2if4, 2.85 Å

PDB Description: Crystal structure of a multi-domain immunophilin from Arabidopsis thaliana

PDB Compounds: (A:) AtFKBP42

SCOPe Domain Sequences for d2if4a1:

Sequence; same for both SEQRES and ATOM records:

>d2if4a1 d.26.1.0 (A:35-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nvppkvdseaevldekvskqiikeghgskpskystcflhyrawtknsqhkfedtwheqqp
ielvlgkekkelaglaigvasmksgeralvhvgwelaygkegnfsfpnvppmadllyeve
vigfde

Timeline for d2if4a1:

• d2if4a1 first appeared in SCOPe 2.03
  
• d2if4a1 appears in SCOPe 2.05
  
• d2if4a1 appears in the current release, SCOPe 2.08