SCOPe 2.06: Domain d2i6tb2: 2i6t B:319-471

Lineage for d2i6tb2 (2i6t B:319-471)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225157] (2 PDB entries)

8. Domain d2i6tb2: 2i6t B:319-471 [204728]
   Other proteins in same PDB: d2i6ta1, d2i6tb1
   automated match to d1ez4a2
   complexed with gol, so4

Details for d2i6tb2

PDB Entry: 2i6t, 2.1 Å

PDB Description: orthorhombic structure of the ldh domain of human ubiquitin- conjugating enzyme e2-like isoform a

PDB Compounds: (B:) ubiquitin-conjugating enzyme e2-like isoform a

SCOPe Domain Sequences for d2i6tb2:

Sequence, based on SEQRES records:

>d2i6tb2 d.162.1.0 (B:319-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cnldsqrlqyiitnvlkaqtsgkevwvigeqgedkvltwsgqeevvshtsqvqlsnrame
llrvkgqrswsvglsvadmvdsivnnkkkvhsvsalakgyydinsevflslpcilgtngv
sevikttlkedtvteklqssassihslqqqlkl

Sequence, based on observed residues (ATOM records):

>d2i6tb2 d.162.1.0 (B:319-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cnldsqrlqyiitnvlkaqtsgkevwvigeqgedkvltwsgqeevvshtsqvqlsnrame
llrvkgqrswsvglsvadmvdsivnnkkkvhsvsalakgyydinsevflslpcilgtngv
sevikttlktvteklqssassihslqqqlkl

Timeline for d2i6tb2:

• d2i6tb2 first appeared in SCOPe 2.03
  
• d2i6tb2 appears in SCOPe 2.05
  
• d2i6tb2 appears in SCOPe 2.07
  
• d2i6tb2 appears in the current release, SCOPe 2.08