SCOPe 2.06: Domain d2i6tb1: 2i6t B:182-318

Lineage for d2i6tb1 (2i6t B:182-318)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)

8. Domain d2i6tb1: 2i6t B:182-318 [204727]
   Other proteins in same PDB: d2i6ta2, d2i6tb2
   automated match to d1ez4a1
   complexed with gol, so4

Details for d2i6tb1

PDB Entry: 2i6t, 2.1 Å

PDB Description: orthorhombic structure of the ldh domain of human ubiquitin- conjugating enzyme e2-like isoform a

PDB Compounds: (B:) ubiquitin-conjugating enzyme e2-like isoform a

SCOPe Domain Sequences for d2i6tb1:

Sequence, based on SEQRES records:

>d2i6tb1 c.2.1.0 (B:182-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdleifnlpnveiskdls
asahskvviftvnslgssqsyldvvqsnvdmfralvpalghysqhsvllvasqpveimty
vtwklstfpanrvigig

Sequence, based on observed residues (ATOM records):

>d2i6tb1 c.2.1.0 (B:182-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnkitvvgggelgiactlaisakgiadrlvlldlseggatmdleifnlpnveiskdlsas
ahskvviftvnsqsyldvvqsnvdmfralvpalghysqhsvllvasqpveimtyvtwkls
tfpanrvigig

Timeline for d2i6tb1:

• d2i6tb1 first appeared in SCOPe 2.03
  
• d2i6tb1 appears in SCOPe 2.05
  
• d2i6tb1 appears in SCOPe 2.07
  
• d2i6tb1 appears in the current release, SCOPe 2.08