Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.11: Prokaryotic SH3-related domain [82057] (5 families) |
Family b.34.11.0: automated matches [227178] (1 protein) not a true family |
Protein automated matches [226895] (1 species) not a true protein |
Species Anabaena variabilis [TaxId:240292] [225110] (1 PDB entry) |
Domain d2hbwa1: 2hbw A:14-86 [204532] Other proteins in same PDB: d2hbwa2 automated match to d2evra1 complexed with act, unl |
PDB Entry: 2hbw (more details), 1.05 Å
SCOPe Domain Sequences for d2hbwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hbwa1 b.34.11.0 (A:14-86) automated matches {Anabaena variabilis [TaxId: 240292]} sgeyqclaalnlydspectslatqaavgrhlqvtsnqqgaavevclceddypgwlslgdl gllkpatvlyqak
Timeline for d2hbwa1: