Lineage for d2hbwa2 (2hbw A:87-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927487Family d.3.1.16: NlpC/P60 [142873] (2 proteins)
    Pfam PF00877
  6. 2927493Protein automated matches [226896] (1 species)
    not a true protein
  7. 2927494Species Anabaena variabilis [TaxId:240292] [225111] (1 PDB entry)
  8. 2927495Domain d2hbwa2: 2hbw A:87-234 [204533]
    Other proteins in same PDB: d2hbwa1
    automated match to d2evra2
    complexed with act, unl

Details for d2hbwa2

PDB Entry: 2hbw (more details), 1.05 Å

PDB Description: crystal structure of a putative endopeptidase (ava_3396) from anabaena variabilis atcc 29413 at 1.05 a resolution
PDB Compounds: (A:) NLP/P60 protein

SCOPe Domain Sequences for d2hbwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hbwa2 d.3.1.16 (A:87-234) automated matches {Anabaena variabilis [TaxId: 240292]}
sfseseikkllpgaiaftqkamqqsnyylwggtvgpnydcsglmqaafvsvgiwlprday
qqeaftqaitidelapgdlvffgtpvkathvglylgdgcyihssgkaqgrdgigidilse
qgdvvsrsyyqqlrgagrvvksykpqrh

SCOPe Domain Coordinates for d2hbwa2:

Click to download the PDB-style file with coordinates for d2hbwa2.
(The format of our PDB-style files is described here.)

Timeline for d2hbwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hbwa1