SCOPe 2.03: Domain d2hbwa1: 2hbw A:14-86

Lineage for d2hbwa1 (2hbw A:14-86)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.11: Prokaryotic SH3-related domain [82057] (5 families)

5. Family b.34.11.0: automated matches [227178] (1 protein)
   not a true family

6. Protein automated matches [226895] (1 species)
   not a true protein

7. Species Anabaena variabilis [TaxId:240292] [225110] (1 PDB entry)

8. Domain d2hbwa1: 2hbw A:14-86 [204532]
   Other proteins in same PDB: d2hbwa2
   automated match to d2evra1
   complexed with act, unl

Details for d2hbwa1

PDB Entry: 2hbw, 1.05 Å

PDB Description: crystal structure of a putative endopeptidase (ava_3396) from anabaena variabilis atcc 29413 at 1.05 a resolution

PDB Compounds: (A:) NLP/P60 protein

SCOPe Domain Sequences for d2hbwa1:

Sequence; same for both SEQRES and ATOM records:

>d2hbwa1 b.34.11.0 (A:14-86) automated matches {Anabaena variabilis [TaxId: 240292]}
sgeyqclaalnlydspectslatqaavgrhlqvtsnqqgaavevclceddypgwlslgdl
gllkpatvlyqak

Timeline for d2hbwa1:

• d2hbwa1 is new in SCOPe 2.03-stable
  
• d2hbwa1 appears in SCOPe 2.04
  
• d2hbwa1 appears in the current release, SCOPe 2.08