![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (42 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:198094] [225238] (1 PDB entry) |
![]() | Domain d2h3gx1: 2h3g X:1-122 [204509] automated match to d3bexa1 complexed with edo |
PDB Entry: 2h3g (more details), 2 Å
SCOPe Domain Sequences for d2h3gx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h3gx1 c.55.1.0 (X:1-122) automated matches {Bacillus anthracis [TaxId: 198094]} mifvldvgntnavlgvfeegelrqhwrmetdrhktedeygmlvkqlleheglsfedvkgi ivssvvppimfalermcekyfkikplvvgpgiktglnikyenprevgadrivnavagihl yg
Timeline for d2h3gx1: